Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (49 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [255519] (12 PDB entries) |
Domain d3rhjb_: 3rhj B: [249097] automated match to d1bxsa_ complexed with gol, nap, so4; mutant |
PDB Entry: 3rhj (more details), 1.89 Å
SCOPe Domain Sequences for d3rhjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rhjb_ c.82.1.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} vinyvekavnkltlqmpyqlfiggefvdaegsktyntinptdgsvicqvslaqvsdvdka vaaakeafenglwgkinardrgrllyrladvmeqhqeelatiealdagavytlalkthvg msiqtfryfagwcdkiqgatipinqarpnrnltltkkepvgvcgivipwnyplmmlswkt aaclaagntvvikpaqvtpltalkfaeltlkagipkgvvnilpgsgslvgqrlsdhpdvr kigftgstevgkhimkscalsnvkkvslalggkspliifadcdlnkavqmgmssvffnkg enciaagrlfveesihnqfvqkvveevekmkignplerdtnhgpqnheahlrklveycqr gvkegatlvcggnqvprpgfffqptvftdvedhmyiakeesfgpimiisrfadgdvdavl sranatefglasgvftrdinkalyvsdklqagtvfintynktdvaapfggfkqsgfgkdl geaalneylriktvtfey
Timeline for d3rhjb_: