SCOPe 2.04: Domain d3rhhd_: 3rhh D:

Lineage for d3rhhd_ (3rhh D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (35 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:86665] [226069] (3 PDB entries)

8. Domain d3rhhd_: 3rhh D: [249095]
   automated match to d4o6rb_
   complexed with nap, so4

Details for d3rhhd_

PDB Entry: 3rhh, 2.3 Å

PDB Description: Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from Bacillus halodurans C-125 complexed with NADP

PDB Compounds: (D:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3rhhd_:

Sequence; same for both SEQRES and ATOM records:

>d3rhhd_ c.82.1.0 (D:) automated matches {Bacillus halodurans [TaxId: 86665]}
qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnlaenly

Timeline for d3rhhd_:

• d3rhhd_ is new in SCOPe 2.04-stable
  
• d3rhhd_ appears in SCOPe 2.05
  
• d3rhhd_ appears in the current release, SCOPe 2.08, called d3rhhd1