SCOP 1.63: Domain d1lt4h_: 1lt4 H:

Lineage for d1lt4h_ (1lt4 H:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (18 PDB entries)

8. Domain d1lt4h_: 1lt4 H: [24909]
   Other proteins in same PDB: d1lt4a_
   complexed with gal, glc; mutant

Details for d1lt4h_

PDB Entry: 1lt4, 2 Å

PDB Description: heat-labile enterotoxin mutant s63k

SCOP Domain Sequences for d1lt4h_:

Sequence; same for both SEQRES and ATOM records:

>d1lt4h_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1lt4h_:

• d1lt4h_ first appeared (with stable ids) in SCOP 1.55
  
• d1lt4h_ appears in SCOP 1.61
  
• d1lt4h_ appears in SCOP 1.65
  
• d1lt4h_ appears in the current release, SCOPe 2.08