Lineage for d3rajl2 (3raj L:106-208)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031268Domain d3rajl2: 3raj L:106-208 [249081]
    Other proteins in same PDB: d3raja_, d3rajl1
    automated match to d1c12a2

Details for d3rajl2

PDB Entry: 3raj (more details), 3.04 Å

PDB Description: crystal structure of human cd38 in complex with the fab fragment of antibody hb7
PDB Compounds: (L:) light chain of the Fab fragment of antibody HB7

SCOPe Domain Sequences for d3rajl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rajl2 b.1.1.2 (L:106-208) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfn

SCOPe Domain Coordinates for d3rajl2:

Click to download the PDB-style file with coordinates for d3rajl2.
(The format of our PDB-style files is described here.)

Timeline for d3rajl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rajl1
View in 3D
Domains from other chains:
(mouse over for more information)
d3raja_