SCOPe 2.08: Domain d3r8wc_: 3r8w C:

Lineage for d3r8wc_ (3r8w C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256054] (2 PDB entries)

8. Domain d3r8wc_: 3r8w C: [249069]
   automated match to d3u1ha_
   complexed with act

Details for d3r8wc_

PDB Entry: 3r8w, 2.25 Å

PDB Description: Structure of 3-isopropylmalate dehydrogenase isoform 2 from Arabidopsis thaliana at 2.2 angstrom resolution

PDB Compounds: (C:) 3-isopropylmalate dehydrogenase 2, chloroplastic

SCOPe Domain Sequences for d3r8wc_:

Sequence; same for both SEQRES and ATOM records:

>d3r8wc_ c.77.1.1 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krytitllpgdgigpevvsiaknvlqqagslegvefnfrempiggaaldlvgvplpeeti
saakesdavllgaiggykwdnnekhlrpekgllqiraalkvfanlrpatvlpqlvdastl
krevaegvdlmvvreltggiyfgeprgiktnengeevgfntevyaaheidriarvafeta
rkrrgklcsvdkanvleasilwrkrvtalaseypdvelshmyvdnaamqlvrdpkqfdti
vtnnifgdilsdeasmitgsigmlpsaslsdsgpglfepihgsapdiagqdkanplatil
saamllkyglgeekaakriedavlvalnngfrtgdiysagtklvgckemgeevlksvd

Timeline for d3r8wc_:

• d3r8wc_ first appeared in SCOPe 2.04
  
• d3r8wc_ appears in SCOPe 2.07