Lineage for d3r8kc_ (3r8k C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199172Fold d.60: Probable bacterial effector-binding domain [55135] (1 superfamily)
    duplication of beta-alpha-beta(2) motif: antiparallel beta sheet forms barrel (n=6, S=12)
  4. 2199173Superfamily d.60.1: Probable bacterial effector-binding domain [55136] (5 families) (S)
  5. 2199209Family d.60.1.0: automated matches [254313] (1 protein)
    not a true family
  6. 2199210Protein automated matches [254719] (1 species)
    not a true protein
  7. 2199211Species Human (Homo sapiens) [TaxId:9606] [256053] (3 PDB entries)
  8. 2199218Domain d3r8kc_: 3r8k C: [249062]
    automated match to d2gova1

Details for d3r8kc_

PDB Entry: 3r8k (more details), 2.85 Å

PDB Description: Crystal structure of human SOUL protein (hexagonal form)
PDB Compounds: (C:) Heme-binding protein 2

SCOPe Domain Sequences for d3r8kc_:

Sequence, based on SEQRES records: (download)

>d3r8kc_ d.60.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avetpgwkapedagpqpgsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgkne
kemkikmtapvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvf
vrsfdgfssaqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqkn

Sequence, based on observed residues (ATOM records): (download)

>d3r8kc_ d.60.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avetpgwkapsyeirhygpakwvstsvesmdwdsaiqtgftklnsyiqgknekemkikmt
apvtsyvepgsgpfsestitislyipseqqfdpprplesdvfiedraemtvfvrsfdgfs
saqknqeqlltlasilredgkvfdekvyytagynspvkllnrnnevwliqkn

SCOPe Domain Coordinates for d3r8kc_:

Click to download the PDB-style file with coordinates for d3r8kc_.
(The format of our PDB-style files is described here.)

Timeline for d3r8kc_: