SCOPe 2.08: Domain d3r6mc1: 3r6m C:2-108

Lineage for d3r6mc1 (3r6m C:2-108)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:670] [256052] (1 PDB entry)

8. Domain d3r6mc1: 3r6m C:2-108 [249054]
   automated match to d3zeua1

Details for d3r6mc1

PDB Entry: 3r6m, 3.1 Å

PDB Description: Crystal structure of Vibrio parahaemolyticus YeaZ

PDB Compounds: (C:) YeaZ, resuscitation promoting factor

SCOPe Domain Sequences for d3r6mc1:

Sequence; same for both SEQRES and ATOM records:

>d3r6mc1 c.55.1.0 (C:2-108) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
akilaidtatencsvallvndqvisrsevaprdhtkkvlpmvdevlkeagltlqdldala
fgrgpgsftgvrigigiaqglafgaelpmigvstlaamaqasyrlhg

Timeline for d3r6mc1:

• d3r6mc1 first appeared in SCOPe 2.04
  
• d3r6mc1 appears in SCOPe 2.07