Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [256051] (1 PDB entry) |
Domain d3r4dc2: 3r4d C:108-199 [249049] Other proteins in same PDB: d3r4da1, d3r4dc1 automated match to d1l6za2 complexed with nag |
PDB Entry: 3r4d (more details), 3.1 Å
SCOPe Domain Sequences for d3r4dc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r4dc2 b.1.1.4 (C:108-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qpvtqpflqvtnttvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilri dpikredageyqceisnpvsvrrsnsikldii
Timeline for d3r4dc2: