Lineage for d3r4dc2 (3r4d C:108-199)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.4: I set domains [49159] (39 proteins)
  6. Protein automated matches [190803] (3 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [256051] (1 PDB entry)
  8. Domain d3r4dc2: 3r4d C:108-199 [249049]
    Other proteins in same PDB: d3r4da1, d3r4db_, d3r4dc1, d3r4dd_
    automated match to d1l6za2
    complexed with nag

Details for d3r4dc2

PDB Entry: 3r4d (more details), 3.1 Å

PDB Description: crystal structure of mouse coronavirus receptor-binding domain complexed with its murine receptor
PDB Compounds: (C:) CEA-related cell adhesion molecule 1, isoform 1/2S

SCOPe Domain Sequences for d3r4dc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r4dc2 b.1.1.4 (C:108-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpvtqpflqvtnttvkeldsvtltclsndiganiqwlfnsqslqltermtlsqnnsilri
dpikredageyqceisnpvsvrrsnsikldii

SCOPe Domain Coordinates for d3r4dc2 are not available.

Timeline for d3r4dc2:

Domains from same chain:
(mouse over for more information)
d3r4dc1
Domains from other chains:
(mouse over for more information)
d3r4da1, d3r4da2, d3r4db_, d3r4dd_