Lineage for d3r3je1 (3r3j E:55-257)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890814Species Plasmodium falciparum [TaxId:36329] [256049] (1 PDB entry)
  8. 2890819Domain d3r3je1: 3r3j E:55-257 [249034]
    Other proteins in same PDB: d3r3ja2, d3r3jb2, d3r3jc2, d3r3jd2, d3r3je2, d3r3jf2
    automated match to d1bgva2

Details for d3r3je1

PDB Entry: 3r3j (more details), 3.1 Å

PDB Description: Kinetic and structural characterization of Plasmodium falciparum glutamate dehydrogenase 2
PDB Compounds: (E:) glutamate dehydrogenase

SCOPe Domain Sequences for d3r3je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r3je1 c.58.1.0 (E:55-257) automated matches {Plasmodium falciparum [TaxId: 36329]}
lhnygytstksvdnqieelrekvvsknknepeflqafeevlsclkpvfkkdnvyigvlen
iaeperviqfrvpwindkgehkmnrgfrvqynsvlgpykgglrfhpavnlsvikflgfeq
ifknslttlpmgggkggsdfdpkgkseneilkfcqsfmtnlfryigpntdvpagdigvgg
reigylfgqykklknsfegvltg

SCOPe Domain Coordinates for d3r3je1:

Click to download the PDB-style file with coordinates for d3r3je1.
(The format of our PDB-style files is described here.)

Timeline for d3r3je1: