SCOPe 2.04: Domain d3qvdd1: 3qvd D:2-134

Lineage for d3qvdd1 (3qvd D:2-134)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (24 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)

8. Domain d3qvdd1: 3qvd D:2-134 [249007]
   Other proteins in same PDB: d3qvda2, d3qvdb2, d3qvdc2, d3qvdd2, d3qvde2, d3qvdf2, d3qvdg2, d3qvdh2
   automated match to d3mpsa1
   complexed with fe, fe2, peo

Details for d3qvdd1

PDB Entry: 3qvd, 2 Å

PDB Description: Exposure of rubrerythrin from Pyrococcus furiosus to peroxide, fifteen second time point.

PDB Compounds: (D:) rubrerythrin

SCOPe Domain Sequences for d3qvdd1:

Sequence; same for both SEQRES and ATOM records:

>d3qvdd1 a.25.1.1 (D:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

Timeline for d3qvdd1:

• d3qvdd1 is new in SCOPe 2.04-stable
  
• d3qvdd1 appears in SCOPe 2.05
  
• d3qvdd1 appears in the current release, SCOPe 2.08