Lineage for d1fd7h_ (1fd7 H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59003Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 59051Protein Heat-labile toxin [50205] (2 species)
  7. 59052Species Escherichia coli, type IB [TaxId:562] [50206] (17 PDB entries)
  8. 59082Domain d1fd7h_: 1fd7 H: [24894]

Details for d1fd7h_

PDB Entry: 1fd7 (more details), 1.8 Å

PDB Description: heat-labile enterotoxin b-pentamer with bound ligand bmsc001

SCOP Domain Sequences for d1fd7h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fd7h_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1fd7h_:

Click to download the PDB-style file with coordinates for d1fd7h_.
(The format of our PDB-style files is described here.)

Timeline for d1fd7h_: