Lineage for d3qijb3 (3qij B:397-488)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799448Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)
  8. 1799450Domain d3qijb3: 3qij B:397-488 [248907]
    Other proteins in same PDB: d3qija1, d3qija2, d3qijb1, d3qijb2
    automated match to d1gg3a2
    complexed with unx

Details for d3qijb3

PDB Entry: 3qij (more details), 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r
PDB Compounds: (B:) Protein 4.1

SCOPe Domain Sequences for d3qijb3:

Sequence, based on SEQRES records: (download)

>d3qijb3 b.55.1.0 (B:397-488) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpgeq
eqyestigfklpsyraakklwkvcvehhtffr

Sequence, based on observed residues (ATOM records): (download)

>d3qijb3 b.55.1.0 (B:397-488) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvdlhkakdlegvdiilgvcssgllvykdklrinrfpwpkvlkisykrssffikirpqye
stigfklpsyraakklwkvcvehhtffr

SCOPe Domain Coordinates for d3qijb3:

Click to download the PDB-style file with coordinates for d3qijb3.
(The format of our PDB-style files is described here.)

Timeline for d3qijb3: