SCOPe 2.05: Domain d3qijb2: 3qij B:291-396

Lineage for d3qijb2 (3qij B:291-396)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.0: automated matches [254193] (1 protein)
   not a true family

6. Protein automated matches [254423] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255207] (6 PDB entries)

8. Domain d3qijb2: 3qij B:291-396 [248906]
   Other proteins in same PDB: d3qija1, d3qija3, d3qijb1, d3qijb3
   automated match to d1gg3a1
   complexed with unx

Details for d3qijb2

PDB Entry: 3qij, 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r

PDB Compounds: (B:) Protein 4.1

SCOPe Domain Sequences for d3qijb2:

Sequence; same for both SEQRES and ATOM records:

>d3qijb2 a.11.2.0 (B:291-396) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpaqlteditryylclqlrqdivagrlpcsfatlallgsytiqselgdydpelhgvdyv
sdfklapnqtkeleekvmelhksyrsmtpaqadleflenakklsmy

Timeline for d3qijb2:

• d3qijb2 first appeared in SCOPe 2.04
  
• d3qijb2 appears in SCOPe 2.06
  
• d3qijb2 appears in the current release, SCOPe 2.08