Lineage for d3qijb1 (3qij B:211-290)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2933104Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2933105Protein automated matches [190233] (31 species)
    not a true protein
  7. 2933161Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)
  8. 2933244Domain d3qijb1: 3qij B:211-290 [248905]
    Other proteins in same PDB: d3qija2, d3qija3, d3qija4, d3qijb2, d3qijb3, d3qijb4
    automated match to d1gg3a3
    complexed with unx

Details for d3qijb1

PDB Entry: 3qij (more details), 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r
PDB Compounds: (B:) Protein 4.1

SCOPe Domain Sequences for d3qijb1:

Sequence, based on SEQRES records: (download)

>d3qijb1 d.15.1.0 (B:211-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsake
ikkqvrgvpwnftfnvkfyp

Sequence, based on observed residues (ATOM records): (download)

>d3qijb1 d.15.1.0 (B:211-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdktwldsakeikkq
vrgvpwnftfnvkfyp

SCOPe Domain Coordinates for d3qijb1:

Click to download the PDB-style file with coordinates for d3qijb1.
(The format of our PDB-style files is described here.)

Timeline for d3qijb1: