Lineage for d3qija2 (3qij A:291-396)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725169Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1725208Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1725283Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 1725284Protein automated matches [254423] (3 species)
    not a true protein
  7. 1725288Species Human (Homo sapiens) [TaxId:9606] [255207] (6 PDB entries)
  8. 1725289Domain d3qija2: 3qij A:291-396 [248903]
    Other proteins in same PDB: d3qija1, d3qija3, d3qijb1, d3qijb3
    automated match to d1gg3a1
    complexed with unx

Details for d3qija2

PDB Entry: 3qij (more details), 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r
PDB Compounds: (A:) Protein 4.1

SCOPe Domain Sequences for d3qija2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qija2 a.11.2.0 (A:291-396) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpaqlteditryylclqlrqdivagrlpcsfatlallgsytiqselgdydpelhgvdyv
sdfklapnqtkeleekvmelhksyrsmtpaqadleflenakklsmy

SCOPe Domain Coordinates for d3qija2:

Click to download the PDB-style file with coordinates for d3qija2.
(The format of our PDB-style files is described here.)

Timeline for d3qija2: