![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
![]() | Protein automated matches [190233] (22 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries) |
![]() | Domain d3qija1: 3qij A:211-290 [248902] Other proteins in same PDB: d3qija2, d3qija3, d3qija4, d3qijb2, d3qijb3, d3qijb4 automated match to d1gg3a3 complexed with unx |
PDB Entry: 3qij (more details), 1.8 Å
SCOPe Domain Sequences for d3qija1:
Sequence, based on SEQRES records: (download)
>d3qija1 d.15.1.0 (A:211-290) automated matches {Human (Homo sapiens) [TaxId: 9606]} hckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsake ikkqvrgvpwnftfnvkfyp
>d3qija1 d.15.1.0 (A:211-290) automated matches {Human (Homo sapiens) [TaxId: 9606]} hckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsake ikkqvpwnftfnvkfyp
Timeline for d3qija1:
![]() Domains from other chains: (mouse over for more information) d3qijb1, d3qijb2, d3qijb3, d3qijb4 |