Lineage for d3qija1 (3qij A:209-290)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893780Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)
  8. 1893785Domain d3qija1: 3qij A:209-290 [248902]
    Other proteins in same PDB: d3qija2, d3qija3, d3qijb2, d3qijb3
    automated match to d1gg3a3
    complexed with unx

Details for d3qija1

PDB Entry: 3qij (more details), 1.8 Å

PDB Description: primitive-monoclinic crystal structure of the ferm domain of protein 4.1r
PDB Compounds: (A:) Protein 4.1

SCOPe Domain Sequences for d3qija1:

Sequence, based on SEQRES records: (download)

>d3qija1 d.15.1.0 (A:209-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsa
keikkqvrgvpwnftfnvkfyp

Sequence, based on observed residues (ATOM records): (download)

>d3qija1 d.15.1.0 (A:209-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qghckvsllddtvyecvvekhakgqdllkrvcehlnlleedyfglaiwdnatsktwldsa
keikkqvpwnftfnvkfyp

SCOPe Domain Coordinates for d3qija1:

Click to download the PDB-style file with coordinates for d3qija1.
(The format of our PDB-style files is described here.)

Timeline for d3qija1: