SCOPe 2.04: Domain d3qe2b2: 3qe2 B:246-521

Lineage for d3qe2b2 (3qe2 B:246-521)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 proteins)
   there is an alpha-helical subdomain inserted in this domain
   automatically mapped to Pfam PF00667

6. Protein automated matches [227066] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226187] (5 PDB entries)

8. Domain d3qe2b2: 3qe2 B:246-521 [248861]
   Other proteins in same PDB: d3qe2a1, d3qe2a3, d3qe2b1, d3qe2b3
   automated match to d1j9za1
   complexed with ca, fad, fmn, nap

Details for d3qe2b2

PDB Entry: 3qe2, 1.75 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase

PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qe2b2:

Sequence; same for both SEQRES and ATOM records:

>d3qe2b2 b.43.4.1 (B:246-521) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterhlmh
leldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkhpfp
cptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylswvve
arrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveyetka
grinkgvatnwlrakepvgenggralvpmfvrksqf

Timeline for d3qe2b2:

• d3qe2b2 is new in SCOPe 2.04-stable
  
• d3qe2b2 appears in SCOPe 2.05
  
• d3qe2b2 appears in the current release, SCOPe 2.08