Lineage for d3qe2a3 (3qe2 A:522-680)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1589855Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1589856Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 1590016Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 1590017Protein automated matches [226871] (15 species)
    not a true protein
  7. 1590032Species Human (Homo sapiens) [TaxId:9606] [226188] (5 PDB entries)
  8. 1590035Domain d3qe2a3: 3qe2 A:522-680 [248859]
    Other proteins in same PDB: d3qe2a1, d3qe2a2, d3qe2b1, d3qe2b2
    automated match to d1j9za3
    complexed with ca, fad, fmn, nap

Details for d3qe2a3

PDB Entry: 3qe2 (more details), 1.75 Å

PDB Description: Crystal Structure of Human NADPH-Cytochrome P450 Reductase
PDB Compounds: (A:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d3qe2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qe2a3 c.25.1.0 (A:522-680) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

SCOPe Domain Coordinates for d3qe2a3:

Click to download the PDB-style file with coordinates for d3qe2a3.
(The format of our PDB-style files is described here.)

Timeline for d3qe2a3: