Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (3 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [256034] (1 PDB entry) |
Domain d3q7jb3: 3q7j B:415-489 [248801] Other proteins in same PDB: d3q7ja1, d3q7ja2, d3q7ja4, d3q7jb1, d3q7jb2, d3q7jb4 automated match to d1z1wa3 complexed with fbo, zn |
PDB Entry: 3q7j (more details), 2.91 Å
SCOPe Domain Sequences for d3q7jb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7jb3 b.1.30.0 (B:415-489) automated matches {Thermoplasma acidophilum [TaxId: 273075]} gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli kinadsagfyrvlyd
Timeline for d3q7jb3:
View in 3D Domains from other chains: (mouse over for more information) d3q7ja1, d3q7ja2, d3q7ja3, d3q7ja4 |