Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (14 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [256033] (1 PDB entry) |
Domain d3q7jb2: 3q7j B:171-414 [248800] Other proteins in same PDB: d3q7ja1, d3q7ja3, d3q7ja4, d3q7jb1, d3q7jb3, d3q7jb4 automated match to d1z1wa2 complexed with fbo, zn |
PDB Entry: 3q7j (more details), 2.91 Å
SCOPe Domain Sequences for d3q7jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7jb2 d.92.1.0 (B:171-414) automated matches {Thermoplasma acidophilum [TaxId: 273075]} ryeyekyrdidlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgag amenwgaitfreiymdiaensavtvkrnsatviaheiahqwfgdlvtmkwwndlwlnesf atfmsyktmdtlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeis ygkgasilrmiedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeyw iknp
Timeline for d3q7jb2:
View in 3D Domains from other chains: (mouse over for more information) d3q7ja1, d3q7ja2, d3q7ja3, d3q7ja4 |