Class b: All beta proteins [48724] (180 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (5 species) not a true protein |
Species Thermoplasma acidophilum [TaxId:273075] [256032] (1 PDB entry) |
Domain d3q7jb1: 3q7j B:1-170 [248799] Other proteins in same PDB: d3q7ja2, d3q7ja3, d3q7ja4, d3q7jb2, d3q7jb3, d3q7jb4 automated match to d1z1wa1 complexed with fbo, zn |
PDB Entry: 3q7j (more details), 2.91 Å
SCOPe Domain Sequences for d3q7jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7jb1 b.98.1.0 (B:1-170) automated matches {Thermoplasma acidophilum [TaxId: 273075]} mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfqatdarrmfpcvdhpaykav faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkf
Timeline for d3q7jb1:
View in 3D Domains from other chains: (mouse over for more information) d3q7ja1, d3q7ja2, d3q7ja3, d3q7ja4 |