Lineage for d3q7jb1 (3q7j B:1-170)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820733Species Thermoplasma acidophilum [TaxId:273075] [256032] (1 PDB entry)
  8. 2820735Domain d3q7jb1: 3q7j B:1-170 [248799]
    Other proteins in same PDB: d3q7ja2, d3q7ja3, d3q7ja4, d3q7jb2, d3q7jb3, d3q7jb4
    automated match to d1z1wa1
    complexed with fbo, zn

Details for d3q7jb1

PDB Entry: 3q7j (more details), 2.91 Å

PDB Description: Engineered Thermoplasma Acidophilum F3 factor mimics human aminopeptidase N (APN) as a target for anticancer drug development
PDB Compounds: (B:) Tricorn protease-interacting factor F3

SCOPe Domain Sequences for d3q7jb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7jb1 b.98.1.0 (B:1-170) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mevekydltldfdiqkrtfngtetitadagdivldavglqinwmkvngrdtaftydgqtv
rapgdsqpqkieisfagkvsdslsgiyyagrengmitthfqatdarrmfpcvdhpaykav
faitvvidkdydaisnmppkrievserkvvefqdtprmstyllyvgigkf

SCOPe Domain Coordinates for d3q7jb1:

Click to download the PDB-style file with coordinates for d3q7jb1.
(The format of our PDB-style files is described here.)

Timeline for d3q7jb1: