SCOPe 2.04: Domain d3q6fi2: 3q6f I:108-211

Lineage for d3q6fi2 (3q6f I:108-211)

Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (9 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
Domain d3q6fi2: 3q6f I:108-211 [248791]
Other proteins in same PDB: d3q6fa1, d3q6fc1, d3q6fe1, d3q6fg1, d3q6fi1, d3q6fk1
automated match to d1adql2
complexed with peg

Details for d3q6fi2

PDB Entry: 3q6f (more details), 3.19 Å

PDB Description: Crystal structure of Fab of human mAb 2909 specific for quaternary neutralizing epitope of HIV-1 gp120

PDB Compounds: (I:) Light chain of Fab of human mAb 2909

SCOPe Domain Sequences for d3q6fi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q6fi2 b.1.1.2 (I:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d3q6fi2:

Click to download the PDB-style file with coordinates for d3q6fi2.
(The format of our PDB-style files is described here.)

Timeline for d3q6fi2: