SCOPe 2.06: Domain d3q4dc2: 3q4d C:125-368

Lineage for d3q4dc2 (3q4d C:125-368)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (74 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [256030] (2 PDB entries)

8. Domain d3q4dc2: 3q4d C:125-368 [248769]
   Other proteins in same PDB: d3q4da1, d3q4db1, d3q4dc1, d3q4dd1, d3q4de1, d3q4df1, d3q4dg1, d3q4dh1, d3q4di1
   automated match to d2p8ba2
   complexed with ala, dal, mg

Details for d3q4dc2

PDB Entry: 3q4d, 3 Å

PDB Description: Crystal structure of dipeptide epimerase from Cytophaga hutchinsonii complexed with Mg and dipeptide D-Ala-L-Ala

PDB Compounds: (C:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q4dc2:

Sequence; same for both SEQRES and ATOM records:

>d3q4dc2 c.1.11.0 (C:125-368) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
kkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmireaagds
itlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripimadesc
cnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlgftaa
ahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdylsglek
icin

Timeline for d3q4dc2:

• d3q4dc2 first appeared in SCOPe 2.04
  
• d3q4dc2 appears in SCOPe 2.05
  
• d3q4dc2 appears in SCOPe 2.07
  
• d3q4dc2 appears in the current release, SCOPe 2.08