![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (59 species) not a true protein |
![]() | Species Cytophaga hutchinsonii [TaxId:269798] [256030] (2 PDB entries) |
![]() | Domain d3q4db2: 3q4d B:125-368 [248767] Other proteins in same PDB: d3q4da1, d3q4db1, d3q4dc1, d3q4dd1, d3q4de1, d3q4df1, d3q4dg1, d3q4dh1, d3q4di1 automated match to d2p8ba2 complexed with ala, dal, mg |
PDB Entry: 3q4d (more details), 3 Å
SCOPe Domain Sequences for d3q4db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q4db2 c.1.11.0 (B:125-368) automated matches {Cytophaga hutchinsonii [TaxId: 269798]} kkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmireaagds itlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripimadesc cnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlgftaa ahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdylsglek icin
Timeline for d3q4db2: