SCOPe 2.04: Domain d3q45i1: 3q45 I:1-124

Lineage for d3q45i1 (3q45 I:1-124)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries)

8. Domain d3q45i1: 3q45 I:1-124 [248762]
   Other proteins in same PDB: d3q45a2, d3q45b2, d3q45c2, d3q45d2, d3q45e2, d3q45f2, d3q45g2, d3q45h2, d3q45i2
   automated match to d2p8ba1
   complexed with dal, mg, val

Details for d3q45i1

PDB Entry: 3q45, 3 Å

PDB Description: crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val

PDB Compounds: (I:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q45i1:

Sequence; same for both SEQRES and ATOM records:

>d3q45i1 d.54.1.0 (I:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
flgg

Timeline for d3q45i1:

• d3q45i1 is new in SCOPe 2.04-stable
  
• d3q45i1 appears in SCOPe 2.05
  
• d3q45i1 appears in the current release, SCOPe 2.08