SCOPe 2.04: Domain d3q45e2: 3q45 E:125-368

Lineage for d3q45e2 (3q45 E:125-368)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [256030] (2 PDB entries)

8. Domain d3q45e2: 3q45 E:125-368 [248755]
   Other proteins in same PDB: d3q45a1, d3q45b1, d3q45c1, d3q45d1, d3q45e1, d3q45f1, d3q45g1, d3q45h1, d3q45i1
   automated match to d2p8ba2
   complexed with dal, mg, val

Details for d3q45e2

PDB Entry: 3q45, 3 Å

PDB Description: crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val

PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q45e2:

Sequence; same for both SEQRES and ATOM records:

>d3q45e2 c.1.11.0 (E:125-368) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
kkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmireaagds
itlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripimadesc
cnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlgftaa
ahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdylsglek
icin

Timeline for d3q45e2:

• d3q45e2 is new in SCOPe 2.04-stable
  
• d3q45e2 appears in SCOPe 2.05
  
• d3q45e2 appears in the current release, SCOPe 2.08