Lineage for d3q45e1 (3q45 E:1-124)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649420Species Cytophaga hutchinsonii [TaxId:269798] [256029] (2 PDB entries)
  8. 1649434Domain d3q45e1: 3q45 E:1-124 [248754]
    Other proteins in same PDB: d3q45a2, d3q45b2, d3q45c2, d3q45d2, d3q45e2, d3q45f2, d3q45g2, d3q45h2, d3q45i2
    automated match to d2p8ba1
    complexed with dal, mg, val

Details for d3q45e1

PDB Entry: 3q45 (more details), 3 Å

PDB Description: crystal structure of dipeptide epimerase from cytophaga hutchinsonii complexed with mg and dipeptide d-ala-l-val
PDB Compounds: (E:) Mandelate racemase/muconate lactonizing enzyme family; possible chloromuconate cycloisomerase

SCOPe Domain Sequences for d3q45e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q45e1 d.54.1.0 (E:1-124) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
miitqvelykspvklkepfkislgilthannvivrihtasghigygecspfmtihgesmd
tafivgqylakgligtscldivsnsllmdaiiygnsciksafnialydlaaqhaglplya
flgg

SCOPe Domain Coordinates for d3q45e1:

Click to download the PDB-style file with coordinates for d3q45e1.
(The format of our PDB-style files is described here.)

Timeline for d3q45e1: