Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Cytophaga hutchinsonii [TaxId:269798] [256030] (2 PDB entries) |
Domain d3q45a2: 3q45 A:125-368 [248747] Other proteins in same PDB: d3q45a1, d3q45b1, d3q45c1, d3q45d1, d3q45e1, d3q45f1, d3q45g1, d3q45h1, d3q45i1 automated match to d2p8ba2 complexed with dal, mg, val |
PDB Entry: 3q45 (more details), 3 Å
SCOPe Domain Sequences for d3q45a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q45a2 c.1.11.0 (A:125-368) automated matches {Cytophaga hutchinsonii [TaxId: 269798]} kkdkiiqtdytvsidephkmaadavqikkngfeiikvkvggskeldverirmireaagds itlridanqgwsvetaietltllepyniqhceepvsrnlytalpkirqacripimadesc cnsfdaerliqiqacdsfnlklsksagitnalniirlaeqahmpvqvggflesrlgftaa ahvalvskticyydfdtplmfeadpvrggivyqqrgiievpetaglgagyqkdylsglek icin
Timeline for d3q45a2: