SCOPe 2.06: Domain d3q3sa2: 3q3s A:95-215

Lineage for d3q3sa2 (3q3s A:95-215)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Ethr repressor [109978] (2 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [109979] (34 PDB entries)
   Uniprot P96222 22-215

8. Domain d3q3sa2: 3q3s A:95-215 [248745]
   Other proteins in same PDB: d3q3sa1
   automated match to d3g1ma2
   protein/DNA complex; complexed with o8b

Details for d3q3sa2

PDB Entry: 3q3s, 2 Å

PDB Description: EthR from Mycobacterium tuberculosis in complex with compound BDM5683

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d3q3sa2:

Sequence; same for both SEQRES and ATOM records:

>d3q3sa2 a.121.1.1 (A:95-215) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
adtdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavid
aerdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
n

Timeline for d3q3sa2:

• d3q3sa2 first appeared in SCOPe 2.04
  
• d3q3sa2 appears in SCOPe 2.05
  
• d3q3sa2 appears in SCOPe 2.07
  
• d3q3sa2 appears in the current release, SCOPe 2.08