SCOPe 2.05: Domain d3pxla1: 3pxl A:1-130

Lineage for d3pxla1 (3pxl A:1-130)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Trametes hirsuta [TaxId:5327] [255835] (3 PDB entries)

8. Domain d3pxla1: 3pxl A:1-130 [248727]
   automated match to d1kyaa1
   complexed with cu, nag

Details for d3pxla1

PDB Entry: 3pxl, 1.2 Å

PDB Description: type-2 cu-depleted fungus laccase from trametes hirsuta

PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d3pxla1:

Sequence; same for both SEQRES and ATOM records:

>d3pxla1 b.6.1.0 (A:1-130) automated matches {Trametes hirsuta [TaxId: 5327]}
avgpvadltitdaavspdgfsrqavvvngvtpgplvagnigdrfqlnvidnltnhtmlks
tsihwhgffqhgtnwadgpafinqcpispghsflydfqvpdqagtfwyhshlstqycdgl
rgpfvvydpn

Timeline for d3pxla1:

• d3pxla1 first appeared in SCOPe 2.04
  
• d3pxla1 appears in SCOPe 2.06
  
• d3pxla1 appears in the current release, SCOPe 2.08