SCOPe 2.05: Domain d3pxja2: 3pxj A:131-230

Lineage for d3pxja2 (3pxj A:131-230)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255699] (2 PDB entries)

8. Domain d3pxja2: 3pxj A:131-230 [248720]
   automated match to d2v9ta_

Details for d3pxja2

PDB Entry: 3pxj, 2.3 Å

PDB Description: tandem ig repeats of dlar

PDB Compounds: (A:) Tyrosine-protein phosphatase Lar

SCOPe Domain Sequences for d3pxja2:

Sequence; same for both SEQRES and ATOM records:

>d3pxja2 b.1.1.0 (A:131-230) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
egdktpagfpvitqgpgtrvievghtvlmtckaignptpniywiknqtkvdmsnpryslk
dgflqiensreedqgkyecvaensmgtehskatnlyvkvr

Timeline for d3pxja2:

• d3pxja2 first appeared in SCOPe 2.04
  
• d3pxja2 appears in SCOPe 2.06
  
• d3pxja2 appears in the current release, SCOPe 2.08