Lineage for d3pwfb1 (3pwf B:2-134)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1729071Species Pyrococcus furiosus [TaxId:2261] [232940] (4 PDB entries)
  8. 1729073Domain d3pwfb1: 3pwf B:2-134 [248703]
    Other proteins in same PDB: d3pwfa2, d3pwfb2
    automated match to d3mpsa1
    complexed with fe2

Details for d3pwfb1

PDB Entry: 3pwf (more details), 1.64 Å

PDB Description: High resolution structure of the fully reduced form of rubrerythrin from P. furiosus
PDB Compounds: (B:) rubrerythrin

SCOPe Domain Sequences for d3pwfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwfb1 a.25.1.1 (B:2-134) automated matches {Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOPe Domain Coordinates for d3pwfb1:

Click to download the PDB-style file with coordinates for d3pwfb1.
(The format of our PDB-style files is described here.)

Timeline for d3pwfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwfb2