Lineage for d3pwfa2 (3pwf A:135-171)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1706206Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 1706207Protein automated matches [232943] (2 species)
    not a true protein
  7. 1706221Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)
  8. 1706222Domain d3pwfa2: 3pwf A:135-171 [248702]
    Other proteins in same PDB: d3pwfa1, d3pwfb1
    automated match to d3mpsa2
    complexed with fe2

Details for d3pwfa2

PDB Entry: 3pwf (more details), 1.64 Å

PDB Description: High resolution structure of the fully reduced form of rubrerythrin from P. furiosus
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d3pwfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pwfa2 g.41.5.0 (A:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3pwfa2:

Click to download the PDB-style file with coordinates for d3pwfa2.
(The format of our PDB-style files is described here.)

Timeline for d3pwfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pwfa1