SCOPe 2.08: Domain d3pwea3: 3pwe A:245-366

Lineage for d3pwea3 (3pwe A:245-366)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.131: DNA clamp [55978] (1 superfamily)
   contains two helices and two beta sheets
   duplication: fold has internal pseudo two-fold symmetry

4. Superfamily d.131.1: DNA clamp [55979] (3 families)

5. Family d.131.1.0: automated matches [227185] (1 protein)
   not a true family

6. Protein automated matches [226907] (28 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256026] (1 PDB entry)

8. Domain d3pwea3: 3pwe A:245-366 [248697]
   automated match to d4k3lb3
   mutant

Details for d3pwea3

PDB Entry: 3pwe, 2.2 Å

PDB Description: crystal structure of the e. coli beta clamp mutant r103c, i305c, c260s, c333s at 2.2a resolution

PDB Compounds: (A:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d3pwea3:

Sequence; same for both SEQRES and ATOM records:

>d3pwea3 d.131.1.0 (A:245-366) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrvlpknpdkhleagsdllkqafaraailsnekfrgvrlyvsenqlkitannpeqeeaee
cldvtysgaemeigfnvsyvldvlnalksenvrmmltdsvssvqiedaasqsaayvvmpm
rl

Timeline for d3pwea3:

• d3pwea3 first appeared in SCOPe 2.04
  
• d3pwea3 appears in SCOPe 2.07