Lineage for d1djrh_ (1djr H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13632Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 13633Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 13676Protein Heat-labile toxin [50205] (2 species)
  7. 13677Species Escherichia coli, type IB [TaxId:562] [50206] (17 PDB entries)
  8. 13682Domain d1djrh_: 1djr H: [24869]

Details for d1djrh_

PDB Entry: 1djr (more details), 1.3 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl- alpha-d-galactose

SCOP Domain Sequences for d1djrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djrh_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1djrh_:

Click to download the PDB-style file with coordinates for d1djrh_.
(The format of our PDB-style files is described here.)

Timeline for d1djrh_: