SCOPe 2.06: Domain d1djrg_: 1djr G:

Lineage for d1djrg_ (1djr G:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (22 PDB entries)

8. Domain d1djrg_: 1djr G: [24868]
   complexed with bez, gla, gol

Details for d1djrg_

PDB Entry: 1djr, 1.3 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl- alpha-d-galactose

PDB Compounds: (G:) heat-labile enterotoxin

SCOPe Domain Sequences for d1djrg_:

Sequence; same for both SEQRES and ATOM records:

>d1djrg_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1djrg_:

• d1djrg_ first appeared (with stable ids) in SCOP 1.55
  
• d1djrg_ appears in SCOPe 2.05
  
• d1djrg_ appears in SCOPe 2.07
  
• d1djrg_ appears in the current release, SCOPe 2.08