Lineage for d1djrg_ (1djr G:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166279Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 166337Protein Heat-labile toxin [50205] (2 species)
  7. 166338Species Escherichia coli, type IB [TaxId:562] [50206] (18 PDB entries)
  8. 166342Domain d1djrg_: 1djr G: [24868]

Details for d1djrg_

PDB Entry: 1djr (more details), 1.3 Å

PDB Description: heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl- alpha-d-galactose

SCOP Domain Sequences for d1djrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djrg_ b.40.2.1 (G:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1djrg_:

Click to download the PDB-style file with coordinates for d1djrg_.
(The format of our PDB-style files is described here.)

Timeline for d1djrg_: