Lineage for d3puha2 (3puh A:352-574)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775374Species Rhodococcus sp. [TaxId:104109] [232531] (10 PDB entries)
  8. 2775380Domain d3puha2: 3puh A:352-574 [248655]
    Other proteins in same PDB: d3puha1, d3puhb1
    automated match to d3i2ja2
    complexed with gol, so4

Details for d3puha2

PDB Entry: 3puh (more details), 2.3 Å

PDB Description: cocaine esterase, wild-type biologically active dimer
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3puha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3puha2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr

SCOPe Domain Coordinates for d3puha2:

Click to download the PDB-style file with coordinates for d3puha2.
(The format of our PDB-style files is described here.)

Timeline for d3puha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3puha1