Lineage for d1djrd_ (1djr D:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) 
Protein Heat-labile toxin [50205] (2 species) Species Escherichia coli, type IB [TaxId:562] [50206] (17 PDB entries) 
Domain d1djrd_: 1djr D: [24865]
Details for d1djrd_
PDB Entry: 1djr (more details), 1.3 Å
PDB Description: heat-labile enterotoxin b-pentamer complexed with m-carboxyphenyl- alpha-d-galactose
SCOP Domain Sequences for d1djrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1djrd_ b.40.2.1 (D:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn
SCOP Domain Coordinates for d1djrd_:
Click to download the PDB-style file with coordinates for d1djrd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1djrd_:
- d1djrd_ appears in SCOP 1.57
- d1djrd_ appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d1djre_, d1djrf_, d1djrg_, d1djrh_ |
