SCOPe 2.04: Domain d3prlc_: 3prl C:

Lineage for d3prlc_ (3prl C:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.82: ALDH-like [53719] (1 superfamily)
   consists of two similar domains with 3 layers (a/b/a) each; duplication
   core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.82.1: ALDH-like [53720] (3 families)
   binds NAD differently from other NAD(P)-dependent oxidoreductases

5. Family c.82.1.0: automated matches [191448] (1 protein)
   not a true family

6. Protein automated matches [190683] (35 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:86665] [226069] (3 PDB entries)

8. Domain d3prlc_: 3prl C: [248631]
   automated match to d4o6rb_
   complexed with so4

Details for d3prlc_

PDB Entry: 3prl, 2 Å

PDB Description: Crystal structure of NADP-dependent glyceraldehyde-3-phosphate dehydrogenase from Bacillus halodurans C-125

PDB Compounds: (C:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3prlc_:

Sequence; same for both SEQRES and ATOM records:

>d3prlc_ c.82.1.0 (C:) automated matches {Bacillus halodurans [TaxId: 86665]}
qfnanilrngewvesrtgerisisapasgvalgsipalsqeevndaiqgakdaqkiwkir
pihervdllyawadlleerkeiigelimhevakpkksaigevsrtadiirhtadealrln
getlkgdqfkggsskkialvereplgvvlaispfnypvnlaaakiapalvtgntvvfkpa
tqgslsgikmvealadagapegiiqvvtgrgsvigdhlvehpgidmitftggtttgeris
ekakmipvvlelggkdpaivlddadlkltasqivsgafsysgqrctaikrvfvqdsvadq
lvanikelveqltvgspeddaditpvideksaafiqgliddalengatllsgnkrqgnll
sptllddvtpamrvaweepfgpvlpiirvkdaneaislsnqsdyglqasiftkdtdrain
igkhlevgtvhinaktergpdhfpflgvkksglgvqgikpsllsmtrervtvlnl

Timeline for d3prlc_:

• d3prlc_ is new in SCOPe 2.04-stable
  
• d3prlc_ appears in SCOPe 2.05
  
• d3prlc_ appears in the current release, SCOPe 2.08