Lineage for d5nuc__ (5nuc -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries) 
Domain d5nuc__: 5nuc - [24856]
Details for d5nuc__
PDB Entry: 5nuc (more details), 2.1 Å
PDB Description: staphylococcal nuclease, 1-n-pentane thiol disulfide to v23c variant
SCOP Domain Sequences for d5nuc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nuc__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws
SCOP Domain Coordinates for d5nuc__:
Click to download the PDB-style file with coordinates for d5nuc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5nuc__:
- d5nuc__ first appeared (with stable ids) in SCOP 1.55
- d5nuc__ appears in SCOP 1.59
- d5nuc__ appears in the current release, SCOPe 2.08, called d5nuca_
View in 3D