Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries) |
Domain d3pmna1: 3pmn A:249-328 [248527] Other proteins in same PDB: d3pmna2, d3pmna3 automated match to d1rzta1 protein/DNA complex; complexed with 1gc, cl, mg, mn, na |
PDB Entry: 3pmn (more details), 2.2 Å
SCOPe Domain Sequences for d3pmna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pmna1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr maekiieilesghlrkldhi
Timeline for d3pmna1: