SCOPe 2.08: Domain d3pmlb1: 3pml B:247-328

Lineage for d3pmlb1 (3pml B:247-328)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)

8. Domain d3pmlb1: 3pml B:247-328 [248524]
   Other proteins in same PDB: d3pmla2, d3pmla3, d3pmlb2, d3pmlb3
   automated match to d1rzta1
   protein/DNA complex; complexed with 1gc, mg, na

Details for d3pmlb1

PDB Entry: 3pml, 2.6 Å

PDB Description: crystal structure of a polymerase lambda variant with a dgtp analog opposite a templating t

PDB Compounds: (B:) DNA polymerase lambda

SCOPe Domain Sequences for d3pmlb1:

Sequence; same for both SEQRES and ATOM records:

>d3pmlb1 a.60.6.1 (B:247-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
qkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgig
krmaekiieilesghlrkldhi

Timeline for d3pmlb1:

• d3pmlb1 first appeared in SCOPe 2.04
  
• d3pmlb1 appears in SCOPe 2.07