Lineage for d3pmla3 (3pml A:386-575)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239289Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2239467Protein DNA polymerase lambda [102943] (1 species)
  7. 2239468Species Human (Homo sapiens) [TaxId:9606] [102944] (27 PDB entries)
  8. 2239512Domain d3pmla3: 3pml A:386-575 [248523]
    Other proteins in same PDB: d3pmla1, d3pmla2, d3pmlb1, d3pmlb2
    automated match to d1rzta3
    protein/DNA complex; complexed with 1gc, mg, na

Details for d3pmla3

PDB Entry: 3pml (more details), 2.6 Å

PDB Description: crystal structure of a polymerase lambda variant with a dgtp analog opposite a templating t
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3pmla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmla3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpysefacallyftgsa
hfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllglpyrep
aerdw

SCOPe Domain Coordinates for d3pmla3:

Click to download the PDB-style file with coordinates for d3pmla3.
(The format of our PDB-style files is described here.)

Timeline for d3pmla3: