Lineage for d1ez6a_ (1ez6 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries) 
Domain d1ez6a_: 1ez6 A: [24849]
Details for d1ez6a_
PDB Entry: 1ez6 (more details), 1.9 Å
PDB Description: structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
SCOP Domain Sequences for d1ez6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ez6a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws
SCOP Domain Coordinates for d1ez6a_:
Click to download the PDB-style file with coordinates for d1ez6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ez6a_:
- d1ez6a_ appears in SCOP 1.57
- d1ez6a_ appears in the current release, SCOPe 2.08
View in 3D