Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d3peoi_: 3peo I: [248483] Other proteins in same PDB: d3peob2, d3peoc2, d3peog2, d3peoh2 automated match to d2c9ta_ complexed with cu9 |
PDB Entry: 3peo (more details), 2.1 Å
SCOPe Domain Sequences for d3peoi_:
Sequence, based on SEQRES records: (download)
>d3peoi_ b.96.1.0 (I:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq trqvqhysccpepyidvnlvvkfrer
>d3peoi_ b.96.1.0 (I:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} sqanlmrlksdlfnrsypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwkln slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr qvqhysccpepyidvnlvvkfrer
Timeline for d3peoi_: