SCOPe 2.08: Domain d3peog1: 3peo G:1-208

Lineage for d3peog1 (3peo G:1-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d3peog1: 3peo G:1-208 [248481]
   Other proteins in same PDB: d3peob2, d3peoc2, d3peog2, d3peoh2
   automated match to d2c9ta_
   complexed with cu9

Details for d3peog1

PDB Entry: 3peo, 2.1 Å

PDB Description: crystal structure of acetylcholine binding protein complexed with metocurine

PDB Compounds: (G:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3peog1:

Sequence, based on SEQRES records:

>d3peog1 b.96.1.0 (G:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d3peog1 b.96.1.0 (G:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwkln
slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl
sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr
qvqhysccpepyidvnlvvkfrerr

Timeline for d3peog1:

• d3peog1 first appeared in SCOPe 2.04, called d3peog_
  
• d3peog1 appears in SCOPe 2.07