SCOPe 2.08: Domain d1a3ua_: 1a3u A:

Lineage for d1a3ua_ (1a3u A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (268 PDB entries)
   Uniprot P00644 89-223

8. Domain d1a3ua_: 1a3u A: [24848]
   complexed with ca, thp

Details for d1a3ua_

PDB Entry: 1a3u, 2.05 Å

PDB Description: staphylococcal nuclease, cyclohexane thiol disulfide to v23c variant

PDB Compounds: (A:) staphylococcal nuclease

SCOPe Domain Sequences for d1a3ua_:

Sequence; same for both SEQRES and ATOM records:

>d1a3ua_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

Timeline for d1a3ua_:

• d1a3ua_ first appeared (with stable ids) in SCOP 1.55, called d1a3u__
  
• d1a3ua_ appears in SCOPe 2.07